SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5047860|Sb01g003680 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5047860|Sb01g003680
Domain Number 1 Region: 137-255
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.37e-32
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5047860|Sb01g003680
Sequence length 279
Sequence
MSGLYGQGFSPARNLSPQIRSNPDVDSQYLAELLAEHQKLGPFMQVLPICNKLLSQEIMR
VSSIVHNHGFGDFDRHRFRSPSPMSSPNPRANLPGNGFSPWSGLQERLGFPQGTSMDWQG
APPSPSSHVVKKILRLEVPVDSYPNFNFVGRILGPRGNSLKRVEASTGCRVFIRGKGSIK
DPGKEDKLRGKPGYEHLSDPLHILIEAEFPASIIDARLRHAQEIIEELLKPVDESQDFYK
RQQLRELAMLNSTLREDSPHPGSVSPFSNGGMKRAKTGQ
Download sequence
Identical sequences C5WV64
jgi|Sorbi1|5047860|Sb01g003680 XP_002466215.1.57931 4558.Sb01g003680.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]