SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5048322|Sb01g010810 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5048322|Sb01g010810
Domain Number 1 Region: 62-210
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.78e-17
Family Calponin-homology domain, CH-domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5048322|Sb01g010810
Sequence length 693
Sequence
MSLHAARGGAHEDLSWSVIGRRAPGDVTFGDGEGGGGMRRAQLQGQQGAVRVDEASSAST
FRELDEAFLQTQTKIWLGEVLHVRFDEDTLVADLLADGELLFQVSKIIWKRLLKKNIEQL
KQSKVYIFERLSFGRSSGKYMPYSKVDSFLKICQILGLAGIDLFTPSDVVEKRNVRKVCI
CIRSVSKKSHIMHLNVPDFDIVTYTISMPNYVVGGIRRSLEQPQYSSSSSSGYSPRAGSK
ALQQQIIFGGQNDQHEDTHYDSDEAESKLSLLEPEDSVDEDNFAAVLSQFSDAHAPNEES
EGYGESGHDKHEEKSLAESVGSGSLNIGVIDSEFIKLSLLEPEDSVDEDNFAAVLPQFSD
AHAPNEESEGYGESGHDKHEEKSLAESVGSGSLNIGVIDSEFMDSSPLIHNKESCSTHSA
TDQCSRTRMAKCSLSSEESDSTSSHLAFDSGKNYLELNNHSDTDSERIYDGHAKSLDHYI
QENGETLADHPKKEEGDLQKDTGTIVQHCDALACDRESVCSSCEEPRYGLNGEPSDLSSE
SYSGLTPTLNTGGKLPMVSEDPVNNLEPNMTDGVTSDSTYRELNPEVSTRNEMDGSESTD
KPVEAEDIAQDSVTRRPEDDVPKSGKGVLKSVAGGITLAGAVFFMIHLRRSKERSFATVI
PSLSEKSVRSNSRAKNMDKENVHDVYPGGWLKV
Download sequence
Identical sequences C5WNS7
4558.Sb01g010810.1 jgi|Sorbi1|5048322|Sb01g010810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]