SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5048512|Sb01g014200 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5048512|Sb01g014200
Domain Number 1 Region: 206-293
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.64e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 114-173
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000159
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 3 Region: 386-430
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000396
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5048512|Sb01g014200
Sequence length 430
Sequence
MDEQVENFVGHDKGGLAQVPYDGEQPNPYDDVAKQYSEELGDQYNEQPGAQYDEGSANPY
NEEQANVYNEETGNQYNEDPTNSYQEELENAFSGDPDMAQKDNSQVNNVDDDKWPGWPGE
SVFRILVPAQKVGAIIGRKGEFIKKMCEETKARIKILDGPPGVPERAVMISAKDEPDAPL
SPAVDGLLRVHKRITDSSNGESGQLQRSAGNIGPTRLLVPSSQAGSLIGKQGATIKSIQD
SSKSVVRIVENVPPVALNDDRVVEIQGEPLGVQKAVELIASHLRKFLVDRSVLPLFETHM
KMHGMPREQPVPPPQHWGPPQTWGPPPNIPPGGPGFGGNPQFIPPRPQDSYYPTPDAPAM
EKQPHYGISAYGREAPPSGASATGNQPLSHAGSQVTHNMHIPLNYADAVIGAAGASISYI
RRHSGATVTI
Download sequence
Identical sequences jgi|Sorbi1|5048512|Sb01g014200 4558.Sb01g014200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]