SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5048899|Sb01g023190 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5048899|Sb01g023190
Domain Number 1 Region: 106-381,494-622
Classification Level Classification E-value
Superfamily Subtilisin-like 1.44e-77
Family Subtilases 0.0039
Further Details:      
 
Domain Number 2 Region: 398-462
Classification Level Classification E-value
Superfamily PA domain 0.0000785
Family PA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5048899|Sb01g023190
Sequence length 767
Sequence
MELALPFLLLALLASPSLAHANGNGSNTTTYIVFMDPARMPAVHRTPAHWHAAHLESLSI
DPSRHLLYSYSAAAHGFAAALLPGHLPLLRGSPEVLQVVPDEVFQLHTTRSPEFLGLLTP
AYQPAIGNLEAATHDVVIGVLDTGVWPESPSFAGGNLPPPPARWKGVCEAGVDFPPSLCG
RKLVGARSFSRGLHAANGGAIGVGKRTFRSARDRDGHGTHTATTAAGAVVANASLLGYAT
GTARGMAPGARVAAYKVCWPEGCLGSDILAGIDAAVADGVGVLSLSLGGGSAPYFRDTVA
VGAFGAAAAGVFVSCSAGNSGPSGATVSNSAPWVATVGAGTLDRDFPAYVTLPTGVRLPG
VSLYAGPSPSPRPAMLPLLYGGGRDNASKLCLSGTLDPAAVRGKIVLCDRGVNARVEKGA
VVKAAGGAGMILANTAASGEELVADSHLLPAVAVGRMVGDKIREYAARGRGGGRPMAMLS
FGGTVLGVRPSPVVAAFSSRGPNTVVPEILKPDMIGPGVNILAAWTGVAGPTGLAKDGRR
THFNIISGTSMSCPHISGVAALMKAAHPDWSPAAIKSALMTTAYTVDNTNSSLRDAADGS
LANAFAYGAGHVDPQKALSPGLVYDISTNDYAAFLCSLNYSAPHIQVITKTSNVSCPKKF
RPGDLNYPSFSVVFNQKSKPVQRFRRELTNVGPATSVYNVKVISPESVAVTVTPAKLTFK
KAGQKLRYHVTFASKAGQSHAKPDFGWISWVNDEHVVRSPVAYTWKM
Download sequence
Identical sequences C5WN62
XP_002467295.1.57931 jgi|Sorbi1|5048899|Sb01g023190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]