SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5048967|Sb01g027580 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5048967|Sb01g027580
Domain Number 1 Region: 485-589
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.93e-24
Family Protein kinases, catalytic subunit 0.002
Further Details:      
 
Domain Number 2 Region: 81-177
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000619
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5048967|Sb01g027580
Domain Number - Region: 207-266
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00168
Family alpha-D-mannose-specific plant lectins 0.0088
Further Details:      
 
Domain Number - Region: 272-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0474
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5048967|Sb01g027580
Sequence length 710
Sequence
MASLSRLLCLLLLLLVPPLAAAQQLPSTFSASNLTWSPTESNRNLLSGDFAAGFVPSASA
KGRYRFAVWVVGSNSTNNAVIWYAHDLRSYSPHEGDVNSTLAIDAAGQLSWTAGGSNNAT
TIWSLQPTANTTTTPAVLQLNVTGSLVYAAAAWSSFAEPTDTLMPGQAIPEGNFTTTLQS
DNGRYRLVNSATLQFNNSKMYANISSGGNALLNLTADGRLQFSGSELIASDQGTTNRVRR
LTLDDDGNLRLYSLVPKTRTWLVVWQVVQELCTIRGTCAGGRICVPVGADSTSCVCPPGY
RNGSLTDACTPKKNYSGRGDDDKFVRMDFVSFSGGASTTASDQGPLMTKLTPQNLADCER
LCRGNSSCVAFGYKFGGDRTCLQFTGLSDGYWSPATEMSTYLRVAATDNDSNPFTGMTSM
IETVCPVRLALPVPPKQARTTIRNVAIITALFAVELLAGVLSFWAFLRKYSQYREMARTL
GLEYLPAGGPRRFSHAELKQATKDFSDVVGRGAYGTVFRGELPDRRAVAVKQLHGVGGGE
AEFWAEVTIIARMHHLNLVRMWGFCADKDQRMLVYEYVPNGSLDKYLFAGGGGGGGEQGE
QDSSSSPAAGTTGSGRSRWAARTGTSPSGRTRRCTWSGASTTSWTRASPPPTTTPPASPP
WSAWSRRPCGACRTAPRCARPWGKWPRCSRAPSRSPTPSSPQSSASRTTD
Download sequence
Identical sequences C5WQK6
jgi|Sorbi1|5048967|Sb01g027580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]