SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5049234|Sb01g032150 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5049234|Sb01g032150
Domain Number 1 Region: 509-804
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-79
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 61-204
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.72e-28
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5049234|Sb01g032150
Domain Number - Region: 340-387
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000184
Family Pan module (APPLE domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5049234|Sb01g032150
Sequence length 812
Sequence
MATFFMILLLLSLLPLHLSAAPRDTLLLGSSLSVEEHQTDVLQSPEGTFSCGFHSIYESA
FTFSIWYTNSVNKTVVWTANRDRPVHARGAVVTLRKDGTMVLTDYDGAVVWQTEGDLVGV
QYARLLDTGNLVMANSSGMVVWQSFDSPTDTLLPTQHITSTTTLVSTTHLHVPGPYIFHF
TDSSILSLIYDDAGVHEIYWPNPDNGEYQNDRNRYNSTRLGFIDDTGRFFSSDFANQQPL
VASDEGVGIKRRLTLDPDGNLRLYSLNDSDGRWSVSWIAVSQPCNIHGLCGPNGICHYFP
TPTCSCPPGYVMSQPGNWSQGCRPVVDIVCTAKKAQPVKFLRLPGTDFWGSDQQHPDKVS
LQACKNICRKDCTCKGFQYQQGTGTCYPKASLYNGKAYTAPTISTPMMYLKLPVGVNISG
ISVPQTNVLISPRKQHLDCGQMSASTLELFPEIHKSSQGEAKWFYFYGFAGSIFVLEAFF
IASAWCFVLRWELGASEIQAVEEGYNALTSNFRRYSYKELVKATRKFKDELGKGGSGIVY
KGVLDDNREVAVKMLENVRQCEEEFQAELRIIGRINHMNLVRIWGVCSESSHRMLVTEYI
ENGSLAHVLFKGHILLEWRQRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDRNLE
PKIADFGLAKLLNRGSSNQNVSRVRGTIGYIAPEWISSLQITAKVDVYSYGVVLLELVLG
RRVLDMALAANEEVHKVLRKYVAMLALMLDKEEPSSIAEVVDCRLSGQFNYMQVRTLIKL
AVSCVDEDRSKRPTMESIVQMLLLADESCSMC
Download sequence
Identical sequences A0A1Z5S8X7
4558.Sb01g032150.1 jgi|Sorbi1|5049234|Sb01g032150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]