SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5049354|Sb01g034070 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5049354|Sb01g034070
Domain Number 1 Region: 510-592
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000363
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 1197-1279
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000119
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 3 Region: 30-91
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000778
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 4 Region: 220-281
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000778
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 5 Region: 410-471
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000778
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 6 Region: 792-879
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000269
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 7 Region: 648-735
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000269
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 8 Region: 130-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000135
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 9 Region: 320-375
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000135
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 10 Region: 936-999
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000314
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 11 Region: 1025-1076
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000055
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 12 Region: 1111-1162
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000055
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5049354|Sb01g034070
Sequence length 1598
Sequence
MAGHRNSHGKRHSDYTENGGGKRRNPGDDTYAPGPDDTVYRYLCASRKIGSIIGRGGEIA
KQLRTETQAKIRIGESVPGCDERVITIFSSSRKTNTIDDAEDKVCPAQDALFRVHERLAT
DESIGNEDSEEISPQVTVRLLVPSDQIGCFLGKGGHIIQGIRSETGAQIRVLSNDHIPAC
AISGDELLQTMAGHRNSHGKRHSDYTENGGGKRRNPGDDTYAPGPDDTVYRYLCASRKIG
SIIGRGGEIAKQLRTETQAKIRIGESVPGCDERVITIFSSSRKTNTIDDAEDKVCPAQDA
LFRVHERLATDESIGNEDSEEISPQVTVRLLVPSDQIGCFLGKGGHIIQGIRSETGAQIR
VLSNDHIPACAISGDELLQTMAGHRNSHGKRHSDYTENGGGKRRNPGDDTYAPGPDDTVY
RYLCASRKIGSIIGRGGEIAKQLRTETQAKIRIGESVPGCDERVITIFSSSRKTNTIDDA
EDKVCPAQDALFRVHERLATDESIGNEDSEEISPQVTVRLLVPSDQIGCFLGKGGHIIQG
IRSETGAQIRVLSNDHIPACAISGDELLQISGDTVVVRKALHQVSSRLHDNPSKSQHHLA
SSLTQPYPGSTTHLGGSSTAPVVGITPVIPPYGGYKGDAAGDWSSLYQPRRDESSAKEFS
LRLLCAAANVGGVIGKGGGIIKQIRQESGALIKVASSNSDPDDDCIITVSAKEISGDTVV
VRKALHQVSSRLHDNPSKSQHHLASSLTQPYPGSTTHLGGSSTAPVVGITPVIPPYGGYK
GDAAGDWSSLYQPRRDESSAKEFSLRLLCAAANVGGVIGKGGGIIKQIRQESGALIKVAS
SNSDPDDDCIITVSAKEISGDTVVVRKALHQVSSRLHDNPSKSQHHLASSLTQPYPGSTT
HLGGSSTAPVVGITPVIPPYGGYKGDAAGDWSSLYQPRRDESSAKEFSLRLLCAAANVGG
VIGKGGGIIKQIRQESGALIKVASSNSDPDDDCIITVSAKEFFEDPVSPTIDAAVRLQPR
CSEKSDSESAEQSYTTRLLVSTSRIGCLIGKGGSIITEIRRTSRANIRILSKENVPKVAA
EDEEMVQFFEDPVSPTIDAAVRLQPRCSEKSDSESAEQSYTTRLLVSTSRIGCLIGKGGS
IITEIRRTSRANIRILSKENVPKVAAEDEEMVQFFEDPVSPTIDAAVRLQPRCSEKSDSE
SAEQSYTTRLLVSTSRIGCLIGKGGSIITEIRRTSRANIRILSKENVPKVAAEDEEMVQI
SGGLDVARHALVQIATRLKANFFEREGSLSAFPSVIPYHPLPSGASDEPKYLSRDTKPVG
HYLYSSAFRTSDDMIPSDSYASYGGSQISGGLDVARHALVQIATRLKANFFEREGSLSAF
PSVIPYHPLPSGASDEPKYLSRDTKPVGHYLYSSAFRTSDDMIPSDSYASYGGSQISGGL
DVARHALVQIATRLKANFFEREGSLSAFPSVIPYHPLPSGASDEPKYLSRDTKPVGHYLY
SSAFRTSDDMIPSDSYASYGGSQALGGGYGAYSGYSARSSGSGHLEEDMGLTADTVLAPL
VVGTWRRIWGLQRIQCSLLWXWVIWSXFSSLWKASWLL
Download sequence
Identical sequences jgi|Sorbi1|5049354|Sb01g034070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]