SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5049475|Sb01g036170 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5049475|Sb01g036170
Domain Number 1 Region: 96-168
Classification Level Classification E-value
Superfamily PA domain 0.000000111
Family PA domain 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5049475|Sb01g036170
Domain Number - Region: 294-394
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0246
Family Thioltransferase 0.042
Further Details:      
 
Domain Number - Region: 510-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5049475|Sb01g036170
Sequence length 629
Sequence
MMRGQAWLALLLVVALALADAAAGRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGT
LHGWVEYPKSNRKACQSFDQFDISFKPKQAGGRPTFVLVDRGECFFTTKAWNAQNAGAAA
VLVVDDKSEPLITMDNPEEGKEHLENITIPSVLITKKLGESLKKSVENGDMLSVLLDWRE
SLPHPDERVEYEFWTNSNDECGPKCDMQMDFVRSFRGTAQILEKKGYTQFTPHYITWYCP
EAFVSSKQCKSQCINHGRYCAPDPEQDFSQGYDGRDVVVQNLHQICVFKIANETGKPWLW
WDYVHDFALRCPMKDKKYNHDCASDVIKSLGLEMEKINKCIGDPEADVENEILKAEQDAQ
IGHGNRGDVTILPTLVINNRQYRGTLDKVAVMKAICSGFEETTEPAVCLSEEVQTNECLE
NNGGCWLDTANNVTACKDTFRGRVCECPIVRGVKFVGDGYTHCEASGIGRCEINNGGCWQ
ETKDGKTISACSNEVSEGCKCPVGFKGDGEKSCEDIDECKDKLYCQCKGCSCKNTWGSYE
CSCGDDNMLYMREHDTCISKKGTTSTVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDS
EIRAIMAQYMPLDNQEGANQHQVVHANDI
Download sequence
Identical sequences C5X0T6
jgi|Sorbi1|5049475|Sb01g036170 XP_002467906.1.57931 4558.Sb01g036170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]