SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5049652|Sb01g038690 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5049652|Sb01g038690
Domain Number 1 Region: 187-313
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000398
Further Details:      
 
Domain Number 2 Region: 424-527
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-28
Family Canonical RBD 0.00078
Further Details:      
 
Domain Number 3 Region: 305-351
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000009
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5049652|Sb01g038690
Sequence length 727
Sequence
MASAETLARSPSSREPSSDPPRAASSEPHHNGDGPGAGAGDSSRRRRRSRWEQSNDDSAA
NNSGGEGGTGGRKRKTRWAEEEPRPAIALPDFMKDFAAEMDPEVHALNARLLEISRLLQS
GLPLDDRPEGARSPSPEPVYDNIGIRINTREYRARERLNRERQEIISQLIRRNPAFKPPS
DYRPPKLQKKLYIPMKEYPGYNFIGLIIGPRGNTQKRMEKETGAKIVIRGKGSVKEGKLL
QKRDLKPDPSENEDLHVLVEADTQEALDAAAGMVEKLLTPVDEVLNEHKRQQLRELAALN
GTIRDDEFCRTCGEAGHRQYACPNKMNTFKSDVQCKICGDGGHPTIDCPVKGTSGKKMDD
EYQNFLAELGGGSAPESMNKSGGPMLALTGSGGSGGASAGTGSNPPWSTNGGAAATGLNG
IKKDYDETNLYIGYLPPTMDDAGLVSLFSQFGDIVMAKVIKDRNTGQSKGYGFVKYSDVS
QANAAIAAMNGHHLEGRVIAVRVAGKPPQPAPAVSAPPSYPPPTDPTSGGYSSQSYMGAP
PPPPPPGSYAPVPWGQPPPYASYPPPPPGSSVYNPAPPAPGQAVPPPYGVQYPPPPPPPP
AAPIPPPGTAPSSDGAQNYPPGVTPPSSGTPTHPVATSVYASSGAPNAPSMYPPPPYSYS
PYYPSPFQPPPPPPPASVNPSQSIATAPWATHSAVPPPLPPLSSTTDQPTASYGADAEYD
KFMSEMK
Download sequence
Identical sequences C5WNL2
4558.Sb01g038690.1 jgi|Sorbi1|5049652|Sb01g038690 XP_002465427.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]