SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5049819|Sb01g041200 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5049819|Sb01g041200
Domain Number 1 Region: 104-193
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000144
Family alpha-D-mannose-specific plant lectins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5049819|Sb01g041200
Sequence length 324
Sequence
MQLSVPPHIVVCLALAFLLLPSHAAATATAPAGTLQRETKQQILASIPPHWDENPVLFLT
SPSGKYAAYFMRTQTTPGAGGLGADFCYVEVLDTTAPGAEGRSVWESECMAVSTVNTCAL
VFSWNGLEVFDGSTSVWHTHDTRSDDHNFLQTLQLVDHGDMRILDKGGELAWKASDEPRA
AQHCGMPGSPGLASALPPFAEPIGHGSSDLPFGQGDGYGNGVGVGVGVGAGGVAQPEAPL
AAPLPQPELPLAPLPQEADQFGGAAAAAGQGQTVQDVGQTFGFGNQPLVDNSPYDSGALK
HGCSLVGNSVALGLTVAVAMGLGL
Download sequence
Identical sequences C5WQZ3
jgi|Sorbi1|5049819|Sb01g041200 XP_002465564.1.57931 4558.Sb01g041200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]