SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5049907|Sb01g042550 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5049907|Sb01g042550
Domain Number 1 Region: 473-593
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-27
Family Protein kinases, catalytic subunit 0.0018
Further Details:      
 
Domain Number 2 Region: 55-153,185-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.13e-26
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5049907|Sb01g042550
Sequence length 678
Sequence
MLILVFLLFSSVDLQISGATDTLTLGQSLPWNQTLVSKGGNFELGLFSPGNSKKHYIGIW
FKKVSKQTVVWVANRDRPILDPSASRFTLSGRGELLLTTPSNTLLWSSNASSPSPPRSTV
ATLQDDGNLVVRSNASASASASVAWQSFDHPTDTWLPGARLGYDRARGVHSFLTSWTDSE
NPAPGAFSMEIDRRGQAKFDLLAGGTNQYWTTGVWDGEVFANVPEMRSGYFDGVPYAPNA
SVNFFSYKNRIPGIGNFVLEVNGQMQRRQWSPEAGKWILFCSEPHDGCDVYGSCGPFGVC
SNTSSAMCECPAAFAPRSQGQWKLGNTASGCVRRTKLDCPNDGFLKLPYAVQLPVGSAES
AGARSDKMCALSCLRDCSCTAYAYEATKCLVWNGELVNLRTLPGDQGVAGAVVLHVRVAA
SEVPPPAPHHSWRKSIVILSSSVSAVVLLLAGLIIVVAVAVVLRKRRGKGKVTAVQGSLL
LFDYQAVKSATRDFTEKLGSGSFGSVYKGTLPDTTPVAVKKLDGLRQGEKQFRAEVVTLG
MIQHINLVRLRGFCCEGNKRALVYDYMPNGSLDAHLFKNSSSSKVLSWSERLHAGDVVGL
LDEKIAGDANVKELEKVCKVACWCIQDEESDRPTMGLVVQQLEGVADVDLPPIPSRLHML
AMMNNGSKLDTEVQVCNE
Download sequence
Identical sequences jgi|Sorbi1|5049907|Sb01g042550 4558.Sb01g042550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]