SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5050153|Sb01g046370 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Sorbi1|5050153|Sb01g046370
Domain Number - Region: 123-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00157
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 48-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0401
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5050153|Sb01g046370
Sequence length 231
Sequence
MLAAGGSRGGVPRAAAVVVAVLALSAVAAADIFSPLAPMFSPVINSICSTVACGQGNCTV
APGTLGYRCDCRPGWTQLHVGDNLRFLPCVIPNCSIDSSCSSGSPAPAPALALSPLPAPK
NFSLDPCELAYCGAGGTCRKSDSRLSYHCECKEGHSNLLNMTMMPCFKNCSFGADCAIIG
IHPSSNSPPAPPPPGSESISNQGNAGAPGSISQRILLPLLVAVSLAVGQAI
Download sequence
Identical sequences jgi|Sorbi1|5050153|Sb01g046370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]