SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5050504|Sb02g002020 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5050504|Sb02g002020
Domain Number 1 Region: 354-642
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-75
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5050504|Sb02g002020
Domain Number - Region: 272-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0296
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5050504|Sb02g002020
Sequence length 698
Sequence
MKHPIAIARLLSIRRLLLLVLQQLCLLVPLVSVLSAAAAVPPPPPAHRRPEGCPSRCGDV
DIPYPFGIGDQCAIDGGFDLSCSLVNGTHYRPFSGPFEVTNISIPDAKAWTKMNISWRCY
DSRTNPTTWSTRRENFTHTPFRFSHQDNKIFVVGCNTLGYITSEYYSIGCLSECYNKPRN
MSSCSVGSGCCEADVPIDMGYSRSFFNPEYNYTGCGYIAVMEEKMFSYSTTYRDSSTSFF
DAYNGTVPVVMDWRIRRYTCEEAKLNISSSYACISYNSQCVNTTNGPGYRCKCQDGYQGN
PYVRDGCTGASVGLVVLVVTLTCAYLIQQRKLHHTKQRYIQQYGDMWIFEKMKSQQGFKI
FTEAQLQEATNKFNEKRVLGHGGQGTVYKGLVEGNVEVAVKRCMSVDEQHKREFGKEMLI
LSQINHKNIVKLLGCCLEVQVPMLVYEFIPNGTLFQLIHGNHGRQISLAIRIQIAHQSAE
ALAYLHSWASPPIFHGDVKSSNILIDRDYTAKVSDFGASILAPTDESQFVTFVQGTCGYL
DPEYMQTCQLTDKSDVYSFGVVLLELLTRKKPFKFDGPEDEKSLAVRFISVAKQGKLEEI
LDDHIKKDESMEVLQEVAELAMQCLEMSGANRPTTKEVSERLDSLRKVMQHAQQQHNNPE
EMEPLLGESSLASSDEVVVSTGNLSIEMEAARSLERGR
Download sequence
Identical sequences jgi|Sorbi1|5050504|Sb02g002020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]