SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5050827|Sb02g009600 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5050827|Sb02g009600
Domain Number 1 Region: 175-211,246-385,537-658
Classification Level Classification E-value
Superfamily Subtilisin-like 9.56e-70
Family Subtilases 0.0029
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5050827|Sb02g009600
Domain Number - Region: 70-118
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000935
Family Subtilase propeptides/inhibitors 0.011
Further Details:      
 
Domain Number - Region: 443-487
Classification Level Classification E-value
Superfamily PA domain 0.0732
Family PA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5050827|Sb02g009600
Sequence length 826
Sequence
MARSPSNTMLWLLLAVFASLAAAGTAGRRGDDGSRSSPQVYVVYMGAVPPRTSPDLLLES
HLRLLGTVLNRGRRADSVVVHQYKHGFSGFAARLSKDEAAALRRKPGVVSVFADPVYQMH
TTRSWDFLQQTTTTAVKIDDSAAGPAARRRGSSNKKGSSKATTPAAADPSSSSPATDTVV
GLLDSGIWPESPSFNDAGFGRPPSRWKGVCMTGDDFNSSNCNNKLIGARYYDLSSVRGPS
PSNGGSPRDDVGHGTHTSSTAAGSAVTGASYYGLASGTAKGGSAGSRVAMYRVCAEYGCA
GSAILAGFDDAIADGVDVVSVSLGASPYFLPDLYADPIAIGAFHAVAKGVMVVCSAGNSG
PDAATVVNAAPWILTVAATTIDRDFESDVVLGGNNSAVKGVAINFSNLDRSPKYPLITGA
AAKSSSVSDTDSASHCEPGTLNSSKIQGKIVLCHHSQSDTSKLEKADELQSDGAAGCILV
NDGERSVATAYLDFPVTEVTSAAAAAIHKYIASASQPVATITPATTVTEYKPAPVVAYFS
SRGPSGQTGNILKPDIAAPGVNILASWIPPSSLPPGQKQASQFNLVSGTSMACPHVAGAA
ATVKAWNPTWSPAAIRSAIMTTATTLNNERAPMTTDSGSAATPYDLGAGQVHPTAALDPG
LVYDAGEDDYLRFLCNYGYNASTVKLIAGSTLPGRFSCAANASKDLISDLNYPSIAVSGL
LGKGSRTVTVTRAVTNVGAQDAATYTVAISAPTGLDVKVTPSKLEFTRSVKKLAFQVSFS
RSGNVDSLDDGDDDDDDAAAKKGALSGSITWSDGKHLVRSPFVVTS
Download sequence
Identical sequences C5X498
jgi|Sorbi1|5050827|Sb02g009600 4558.Sb02g009600.1 XP_002461867.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]