SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5051024|Sb02g020470 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5051024|Sb02g020470
Domain Number 1 Region: 104-370,484-617
Classification Level Classification E-value
Superfamily Subtilisin-like 1.98e-71
Family Subtilases 0.0023
Further Details:      
 
Domain Number 2 Region: 364-461
Classification Level Classification E-value
Superfamily PA domain 0.00000196
Family PA domain 0.0072
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5051024|Sb02g020470
Domain Number - Region: 47-90
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00765
Family Subtilase propeptides/inhibitors 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5051024|Sb02g020470
Sequence length 768
Sequence
MGSFKLSLLCLVPFLLLAVAAGGDTLTTFIVHVQPPEPEENQQTAGSDREAWYRSFLPED
GRLVHAYNHVASGFAARLTPEEVDALSAMPGFVAAVPEETYELQTTHTPLFLGLDAQRGG
GSPASHGHGGSERGAGVIVCLLDTGISPTHPSFDGDGMPPPPAKWKGRCDFGVPVCNNKL
IGARSFMSVPTAAGNSSSPVDDAGHGTHTASTAAGAVVQGAQVLGQAAGVAVGMAPRAHV
AMYKVCNDTSCLSSDILAGVDAAVGDGCDVISMSIGGVSKPFFRDTIAVGTFGAVEKGVF
VALAAGNRGPNASSVTNEAPWMLTVAASTMDRSIRSTVRLGNGVSFHGESAYQPDVSASA
AFHPLVYAGASGRPYAELCGNGSLDGVDVRGKIVLCKYGSGPDGNITRILKGAVVRSAGG
AGMVLMNGFPQGYSTLADAHVIPASHVDYAAASAIMSYVQSAASPTAKILFGGTILGTSP
APSMAFFSSRGPSLQNPGILKPDITGPGVNVLAAWPPQLQVGPPPPASAVLAGQPGPTFN
IISGTSMSTPHLSGIAAFVKSKHPDWSPAAIRSAIMTTADVTDRAGNAIRNEQRVASDLF
ATGAGHVNPEKAADPGLVYDMAPSDYVGFLCGLYSSQNVSVVARRRVDCSAVTVIPESML
NYPSVSVVFQPTWNWSTPVVVERTVKNVGEEVSPSSVYYAAVDIFDDDVAVAVFPSELVF
SEVNQEQSFKVMVWRRHGGNKGAKMVQGAFRWVSDTYTVRSPISISFT
Download sequence
Identical sequences C5X8Y6
4558.Sb02g020470.1 jgi|Sorbi1|5051024|Sb02g020470 XP_002459999.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]