SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5051238|Sb02g025810 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5051238|Sb02g025810
Domain Number 1 Region: 112-157,184-386,497-625
Classification Level Classification E-value
Superfamily Subtilisin-like 4.32e-79
Family Subtilases 0.004
Further Details:      
 
Domain Number 2 Region: 404-469
Classification Level Classification E-value
Superfamily PA domain 0.000011
Family PA domain 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5051238|Sb02g025810
Domain Number - Region: 35-109
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000731
Family Subtilase propeptides/inhibitors 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5051238|Sb02g025810
Sequence length 774
Sequence
MLPMQQLLVLLLLFIGSAKYAAVASGADAGAGAATYIVYLNPALKPSPYATHLHWHHAHL
DSLSLDPARHLLYSYTTAAPSAFAARLFPSHVAALRSHPAVASVHEDVLLPLHTTRSPSF
LHLPQYNAPDEANGGGGPDVIIGVLDTGVWPESPSFGDAGLGPVPARWRGSCETNATDFP
SSMCNRRLIGARAFFRGYSSGGIGSGSRVTADLMSPRDHDGHGTHTASTAAGAVVANASL
LGYASGTARGMAPGARVAAYKVCWRQGCFSSDILAGMEKAIDDGVDVLSLSLGGGAFPLS
RDPIAVGALAATRRGIVVSCSAGNSGPSPSSLVNTAPWIITVGAGTLDRNFPAYAELGNG
ETHAGMSLYSGDGLGDDKLPLVYNKGIRAGSNSSKLCMEGTLDAAEVKGKVVLCDRGGNS
RVEKGLIVKQAGGVGMVLANTAQSGEEVVADSHLLPAVAVGAKSGDAIRRYVESDANPEV
ALTFAGTALDVRPAPVVAAFSSRGPNRVVPQLLKPDVIGPGVNILAGWTASVGPTGLLAD
ERRSEFNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYTVDNTESPLLDAA
TNATATPWAFGAGHVDPVSALSPGLVYDASVDDYVAFLCAVGVAPRQIQAITAAGPNVTC
TRKLSSPGDLNYPSFSVVFGRRSSRSTVKYRRELTNVGNAGDTYTVKVTGPSDISVSVKP
ARLQFRRAGDKLRYTVTFRSANARGPMDPAAFGWLTWSSDEHVVRSPISYTWGM
Download sequence
Identical sequences C5XDQ1
jgi|Sorbi1|5051238|Sb02g025810 XP_002460273.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]