SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5051305|Sb02g027080 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5051305|Sb02g027080
Domain Number 1 Region: 77-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.46e-40
Family Glutathione S-transferase (GST), C-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 6-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.57e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5051305|Sb02g027080
Sequence length 222
Sequence
MAEKGVKVLGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRYNPVTKKVPVLVH
DGNPIAESTIIVEYIDEAWKGGYPIMPADPYERAQARFWARFAEEKCNAALYPIFTATGE
AQRKAVQEAQQCLKTLETALEGKKFFGGDAVGYLDIVVGWYAHWLPVMEEVIGAGVVTDK
ELPLMKAWFDRFLAVDVVKAALPDRDRLLAANKARRDQLLSA
Download sequence
Identical sequences C5X303
XP_002460369.1.57931 4558.Sb02g027080.1 jgi|Sorbi1|5051305|Sb02g027080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]