SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5051320|Sb02g027350 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5051320|Sb02g027350
Domain Number 1 Region: 112-344
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.92e-44
Family ABC transporter ATPase domain-like 0.00071
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5051320|Sb02g027350
Domain Number - Region: 346-393
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0815
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5051320|Sb02g027350
Sequence length 729
Sequence
MASGQQQQQHLPNVPRWTPSPPRRQQAHEEGGGGGDEVDADGSAFGGSMRSTDGSAFPFG
SGRSFPFPLPQPSLEISVLQAAANGTGGSGGVGVDGPVAREKSLRRTDEGVVISWEDLWV
SAAGGKGGRVPILCGLNGYARPGEVLAIMGPSGCGKSTLLDALAGRLGSNVSQKGDILIN
GRRQKLAYGTSDDVLMTTLTVREAVHYSAQLQLPSAMAASAKRERAEETLREMGLEAAAD
TRIGGWMHKGISGGQRRRVSICMEILTRPALLFLDEPTSGLDSAASYHVVGRIARLARRE
GMTVVAAVHQPSTEVYGLFHGLCLLAYGRTVFFGPAAETNQFFALSGFPCPSLMNPSDHF
LRTINKDFDKDIEEGLNGEIKMTTAEAIDTLVNSYKASAYMEKVTRQIADIRENGGAVVK
KEWHTSFLTQSLVLTKRSFVNMYRDLGYYWLRFAIYIMLCLCVGTVFYDIGHSYGSILAR
GSLLNFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGASSFTIANTVSAAPYLALISV
VPGAIAYYLVGLQSSFGHFAYFALVLFTTMMVVEGLMMIVASAVPDFLMGIITGAGIQGV
MMLNGGFFRLPNDLPKPVWRYPMYYVAFHKYANQGLYKNEFLGLTFPNNQAGGAATVSGG
QILTDFWQVEMGYSKWVDLGILCGMVVLYRVLFLAIVKLTEKVKPMIKGFRFRNTAPSVH
VAEKGSGTP
Download sequence
Identical sequences 4558.Sb02g027350.1 jgi|Sorbi1|5051320|Sb02g027350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]