SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5051541|Sb02g031070 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Sorbi1|5051541|Sb02g031070
Domain Number - Region: 105-166
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00468
Family alpha-D-mannose-specific plant lectins 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5051541|Sb02g031070
Sequence length 448
Sequence
MASLAIVLLLARISSSIAIPSNYISRSAEQQVIATVAPAIVPDIDGQSAQPFLTSPSGSY
AAYLRRAVDGAAVGHGGDACYVQIQQAGASGSVWESDCTPVGGADACDLAFSPVGLELFA
GGHSLWDTGVDADPGTLSLDDGGDMKIVSKEGVTVWTASGEPWTGQQCGAPLPPVSTAPS
VEALPPPSTASASTKLVTPPAATLAGAGSTDFPVGDQPPPPPLDTLPDLPVQPPVDTAPE
QPLPPPPASPDLPDLSMPPPPAYTTPDSPDQPLMAPPPADMLPDQPLYSSPPPAPATFGP
QTPLLPPFGVPLAAPPTGDTIPGTTTTPSGEPGSPGSVPFSGPSPVGVPHPHGHPHQLPL
GASPPLPDALAPGGVHGAGAGAGQPGAPFGHGQQQAGQGVFGQQPQLLNGEGQPLEDSAG
GWSRTRSESGRVAACMALFALVTLGFGF
Download sequence
Identical sequences C5X6U0
4558.Sb02g031070.1 XP_002460574.1.57931 jgi|Sorbi1|5051541|Sb02g031070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]