SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5051820|Sb02g036040 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5051820|Sb02g036040
Domain Number 1 Region: 478-764
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-74
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 62-155,187-218
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.09e-25
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5051820|Sb02g036040
Domain Number - Region: 354-418
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000143
Family Pan module (APPLE domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5051820|Sb02g036040
Sequence length 824
Sequence
MAPAFFLLPLLLGQILLCAAVDSINSSTPLSGAQKIVSKGNKFTLGFYTPPQGTTTSSNP
SNYYIAIWYSNIQLQTTVWMANPDVPVADPTTAALTIGSDGNLVLQSQNRLLWSTNVSIS
SNSTVAVLQDIGSLDLIDATNSSMVYWRSIDHPTNTWLPGGKLGLNKTTGVSQRLVPWSN
TANPLPGPFSLELDPRGTTQYFIQWNDSITYWTSGPWNGNIFSLVPEMTSGYNYNFQFIN
NVTESYFIYSMKDNNIISRFIIDVDGQIKQLTWVPASQSWILFWSQPRTQCEVYALCGAY
GSCNLNALPFCNCIRGFSQKVQSDWDLQDYSGGCQRRVPLQCQTNSSSAQAQPDKFYTME
SVRLPDNAQTTVAASSQDCQVTCLNNCSCNAYTYNSSGCFVWHGDLINLQDQYSGNGGGT
LFLRLAASELPDSKKSNTVTIGAVVGGVAAVLILLSIVSYFLFQKYRRERTLRISKTAGG
TMIAFRYSDLQHVTNNFSERLGGGAFGSVFKGKLPDSAAIAVKRLDGVQQGEKQFRAEVS
TIGTIQHVNLVRLLGFCSEGSRRLLVYEFMPKGSLDLQLFSGETTTLSWATRYQIALGTA
RGLNYLHEKCRDCIIHCDVKPENILLDESFVPKVADFGLAKLLGREFSRVLTTMRGTRGY
LAPEWISGVAITAKADVFSYGMMLFELISGKRNAGHGEQHGSTFFPTLAASKLHEGDVRT
LLDPKLNGDANVDELTRACKVACWCIQDDETARPTTGQIVQILEGFLDVNMPPVPRSLKV
LGESPDVINFFSDISSSQTSQTQNSTTTSQTRSATSGSSHPQSP
Download sequence
Identical sequences 4558.Sb02g036040.1 XP_002463005.1.57931 jgi|Sorbi1|5051820|Sb02g036040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]