SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5052345|Sb03g000560 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5052345|Sb03g000560
Domain Number 1 Region: 387-460
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 467-548
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 3 Region: 41-98
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000105
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 4 Region: 239-317
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 5 Region: 638-709
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000095
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5052345|Sb03g000560
Sequence length 716
Sequence
MASRMTPSKRPFQKNSSDYNGRGKWQKTKHSSPHKSQFKIEPGVPFFRILCPASKSGNVI
GKGGAIIAKIREETRMRIRVDRAAPGCDERVIFITAVDKDEEASSERGVENDRGVAASTG
AGHDRDGDNSKEGNDDPEGNNSKEQNDDSEKGNGKEEEDGLEKDHSTEEKDDSEKDHIRE
EKDHSEKEHDKEEKDDPFVAKVAESEPERVIPSALKAISLVFDRIFAAGDNNETGNASAA
STPVSLRLLVLYSQAGWLLGKGGSVIKQMSADNGCEIRVLRDNLPSCALLNDKLCQITGE
IDSVRKGLNAVSELLLAHPPKETDAVSGVHSSGSSSRSLFNQSDGLPSGMQSNFHIPLQG
PSQANGPFDIIDLQPPIHGHASVPIESLSFRMLCPQDKVGSIIGKGGNIVKTIQKDTGCE
IKVLDTVPKSEDRIISISGPAHPSDGISPAQNAILHVQRKIMLPTSDKKEGPAICRLIVS
ANQVGCVLGKGGSIIAEMRKLSGAFIIVLSKDKIPRGVPEHDEVVQISGSCEAIQEALMQ
ITARLRNHLFRVDRMPAMGPNMRPPFGLLDSQFGPFAGNHESPSLFHKDFMGRPLDGISA
PWTVKGMRDLSDPLSISDIPGAGHREAGGFSGPGQPSMMPNLTAEVLVPRLIIPALCSED
GGCLDRIREFSEAKITVAEPIADAMDIPVLISGTPDQMHAARSLVQAFVMSESFAP
Download sequence
Identical sequences C5XJK0
jgi|Sorbi1|5052345|Sb03g000560 XP_002457055.1.57931 XP_021311759.1.57931 4558.Sb03g000560.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]