SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5052457|Sb03g002430 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5052457|Sb03g002430
Domain Number 1 Region: 538-825
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.4e-76
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 117-193,220-244
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-24
Family alpha-D-mannose-specific plant lectins 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5052457|Sb03g002430
Sequence length 867
Sequence
MPPSHLLSLLLAVTVAATVDVVHAQGIPFPTPASTNLSTSWTISLKADGHGAQSFDYMDS
TSVSVFLLQSIQSPPQEGLCFAACFYCVAPCEAFLFGVCIVYVDGGGFLSWPNAGSPQVV
WSANRDRLVRENATLSFTAGGDLQLRNTAGGLVWSTGTSGQSVAGMTVTKSGNLVLFDRK
NAAVWQSFDHPTDCLLPGQPLVEGMRLTPNASSTNWTTSNQLYLTVLSDGLYAFAESSPP
QLYYQKTVTTKAGSRKTYMTLTNGSVAIFASSSSVNVSTLQPNSMINMTAGEMEYVRLES
DGHLKLYRYKGIEGWPMVQDILQGQVGSCAYPTVCGAYGICVSGQCTCPTDGTATYFKQI
DDRRINLGCVPVTPISCASMQYHQLLALSNVSYFNYIDTKAALPQMIDEESCKKACLQNC
SCKAAFFQYGGNDTSQGSCYLPTQVFSLQVNQWQETHYSSSAYLKVQITRSPPPIPGPSN
PNGTVSRSTPTRKGRIGAGVIVGSTLAGVIFVLAVIIISLMVIRRRYQSRDDEDDFGEVP
GMTTRFTFEQLKVATEQFSKMIGKGGFGSVFEGQVGEQRVAVKQLDRADQGKRDFLAEVE
TIGNIHHINLVTLIGFCAEKSHRLLVYEYMSQGSLDRWIYSQDASMSLDWHARCRIITDI
AKGLAYLHEECRQRIAHLDIKPQNILLDDNLSAKLSDFGLSKMIDRDKSQVITRMRGTPG
YLAPEWLTSQITEKVDIYSFGVVVMEIISGRKNLDYSRPQESVHLISILQEKARNDQLED
LIDIHSEEMQIHKEEVIQMMRLAMWCLQIDYNKRPQMSVAVKVLEGTVNVETNIEFNFVA
MVPNNLTNDGKLASSAPLLASHLSGPR
Download sequence
Identical sequences C5XL73
XP_002454976.1.57931 jgi|Sorbi1|5052457|Sb03g002430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]