SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5052867|Sb03g009630 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5052867|Sb03g009630
Domain Number 1 Region: 82-112
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000034
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5052867|Sb03g009630
Domain Number - Region: 139-182
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0936
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5052867|Sb03g009630
Sequence length 466
Sequence
MAREPSPEIDDELFNEVYGKAYSGPVASAANSATPKVNAEKRPLTRDKSDDEDEAPDPNA
VPTDFTSREAKVWEAKAKATERNWKKRKEEEMICKICGDSGHFTQGCPSTLGANRRNADF
FERVPARDKQVRDLFNDRIISQIERDVGCKIRMDEKFLFVSGKDRLILAKGVDAVHKIIQ
EGKGKHSPSSPKPDRSRSPVRNTTEFRPRHSDSHRSHSPRNYDSQRSHSPRNASHSQSKG
YHNERHLDGRLHNNMPRFSKGSSQAHANFGAKGRPAQSKSPRHTSYLDEFPRTHGENNQF
ASHVPNDWGIERHGADGSSSLKFEMPSHQQTLEELELEFKREATQLARARDQEEDEENHR
HRESLRVIRENYMERVITMRNLHSRKWEEFLEQTFKRQQAQPSYTQTGYPGFEQRTTHIS
ATHQPMDSKRTYPYASDSYSAPKAHAAYGEFQHERHDDLGRTYGRY
Download sequence
Identical sequences C5XFS9
jgi|Sorbi1|5052867|Sb03g009630 XP_002457571.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]