SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5053139|Sb03g021860 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5053139|Sb03g021860
Domain Number 1 Region: 156-656
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.84e-166
Family Calponin-homology domain, CH-domain 0.00000000000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5053139|Sb03g021860
Sequence length 698
Sequence
MGFDGLVVVSDPYLQRRFTQADLRVLQTQYAALRDASPNGRLRIRDLPAAISSVRGRGAV
RGRDAEKENSAPEPGPGLGLTDEEWASVLKAVARADEKPHQDASFELFLRVYAEMQLRLK
AASGGGAGRAGGIARSSSSSAVAFLTAATTTLLHTISESEKASYVGHINAYLAEDPFLKT
ALPIDPATDHIFHVTKDGVLLCKLINLAVPGTIDERAINTKRVLNLWEKNENHTLCLNSA
KAIGCTVVNIGTQDLAEGRPHLVLGLISQIIKIQLLADVNLKSTPQLVELVEDSKEMEEL
MSLSPEKILLRWMNFQLKKGGFQKTVTNFSSDIKDSEAYACLLNVLAPECSAKPSAMSVK
DLLHRARLILEHADRMGCKRYLTPKDIVDGLPNLNLAFVAHIFQKRNGLSKQMKQVSFVD
GLSDDAQVSREERSFRLWINSLGISTYINNVFEDLRNGWVLLEVIDKIAPGSVNWKMANR
PPIKLPFRKVENCNQVLKIGKELKFSLVNIAGNDIVQGNKKLILAFLWQLMRYNILQLLK
NLRFHSNGKEITDNDILAWANKKVKDSGKHHSHMQSFKDKSLSSGTFFLDLLSAVEPRVV
NWSLVTKGEKDEEKQMNASYIISVARKLGCSIFLLPEDILEVNQKMMLTLTASIMYWYLK
RPTSHSLDSENGSSCETTSITTSDDSASESSIDDNTTR
Download sequence
Identical sequences C5XM26
4558.Sb03g021860.1 XP_002457922.1.57931 jgi|Sorbi1|5053139|Sb03g021860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]