SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5053604|Sb03g032750 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5053604|Sb03g032750
Domain Number 1 Region: 145-244
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000392
Family Eukaryotic type KH-domain (KH-domain type I) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5053604|Sb03g032750
Sequence length 351
Sequence
MASEDEANAAAAVAEDAEAAEGRNWRRKGKHDKPKPWDEDPNIDRWKIEKFDPAWNEGGM
LEVSSFSTLFPQYREKYLQEAWPLVKGALKEYGISCELNLVEGSMTVSTTRKTRDPFIIV
KARELIKLLSRSVPAPQAIKILDDEMNCDIIKIGGLVRNKERFVKRRERLLGPNLSTLKA
IEILTGCYILVQGNTVAAMGNYRGRGLKQVRRIVEDCMKNVKHPVYHIKELLIKRELAKN
PALATESWDRFLPKFKKKNVKQKKPQTKEKKPYTPFPPPQQPSKIDLELENGEYFMSDKK
KSAKKWQEKLEKQSGRAEENKRKRETFFVICCRRTLQVHLNLTRMPVTTVR
Download sequence
Identical sequences jgi|Sorbi1|5053604|Sb03g032750 4558.Sb03g032750.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]