SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5053680|Sb03g034150 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5053680|Sb03g034150
Domain Number 1 Region: 67-109,336-569
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.43e-71
Family FolH catalytic domain-like 0.0000306
Further Details:      
 
Domain Number 2 Region: 115-354
Classification Level Classification E-value
Superfamily PA domain 2.49e-60
Family PA domain 0.0000353
Further Details:      
 
Domain Number 3 Region: 571-725
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 3.27e-34
Family Transferrin receptor-like dimerisation domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5053680|Sb03g034150
Sequence length 728
Sequence
MSRLDAASLLAPWPPLAKPHPRGRFLCLLSSMLAVLGASLAVLLFFALQPVPNVVPNYEA
LFLSLGSNDTAASHLRALTLHPHVAGTKANAITARYVLDALSALSFPAHITPYSVLLSYP
VHRSLSLSAPGRGVVTSFSLKQETYPNDPYAAAAAETIPTFYAYAASGSVSAEAVYANYG
REEDFAYLASRGVDVAGKVALARYGRIHCEDIAHNARAAGTAAAVVYTDPLEYGGAPGEG
WFPDSRWLPPSGVQVGSLFRGVGDPTTPMWASSEGCERVSVEEAMNTDDMPLIPALPVSA
QDAMEIHRAMGGAVAPADWQSRKGSPVYHLGPGPAVLNLTYLGNDTMATIENVFAIIEGT
EEPDRYVILGNHRDAWTFGASDPNSGTAAMIELAQRFSMLQKQGWRPRRTIIFCSWDAEE
YGLTGSTEWVEENQEMLYSRAVAYLNVDVSVVGPGFLPSTTPQLDELLQQVQDPDNSSQT
VYDSWIKLSFPPRVLRLGDGGSDYSAFVQHVGIPSMNIIFGEGPGYPVYHSLYDDYVWMA
KFGDPGFRRHVAAASIWGMMALRLANEEILPFNYMSYAIELEEYTKTVENEVKGTTVTCS
PLYNSIRTLRAAATKVNNEQKELQKQLLSKQLNKDSLRIRQLNDRLMQTERAFTSREGIF
KLEWFKHLVYGPSDQNDWDTAVYPGIANAIASARSSNTSESWKFVQHEVYRVARAVTQAS
AILSGRLT
Download sequence
Identical sequences 4558.Sb03g034150.1 jgi|Sorbi1|5053680|Sb03g034150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]