SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5053688|Sb03g034260 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5053688|Sb03g034260
Domain Number 1 Region: 67-109,332-567
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.34e-69
Family FolH catalytic domain-like 0.0000179
Further Details:      
 
Domain Number 2 Region: 115-350
Classification Level Classification E-value
Superfamily PA domain 1.83e-63
Family PA domain 0.000012
Further Details:      
 
Domain Number 3 Region: 569-723
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 4.19e-39
Family Transferrin receptor-like dimerisation domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5053688|Sb03g034260
Sequence length 726
Sequence
MPPPQDGAHDSAARVPLLPPPAPRRAAVRLRPLPLLIAAAFAASYRLLFHLAPAPSYYQS
LLLSLGSNDTAAAHLHALTIRPHLAGTGANALAAAHVASALSSHSFPTRLTSYSVLLSYP
AHRSLSLSAPDRDTVLFALKQETYAGDPYDAVSDEAVPTFLAYAASGSVTAEAVYANYGR
AEDYAYLAARGVNVTGKVAVARYGKVFRGDIVRNARDAGAAAAVIYTDAKDYAAGKAFPD
GPWMPPTGVQVGSTFKGVGDPTTPMWPSSEGCERLSVAEAMSSDDMPGIPALPVSWMDGE
TILQLIGGDVAPKDWQGGDGAAAYRIGPGPAVLNLTYIGNETMVTIQNVISVIEGREEPE
RYVILGNHRDAWTFGAADPNSGTATLLELAQRLSELQKKGWTPRRTIILCNWDAEEYGLT
GSTEWVEENRAMLTSRTVAYLNVDIAVDGYGFYASATPQLDELLKEASKQVQNPNNGTQS
LYDLWMASNSSPLIGRLGGGGSDYSAFVQHIGIPSVDMTIGSDYAVYHSLYDDFIWMEKF
GDPLFQRHVAVASMWGLVALRLSDEEILPFNYSNYATELENGALDISESVLGVSVSLSPL
HKSIKEFRKAVLKVDSELKALQTWKFWAPWKNSPLKVRDINDRLMMTERAFTDREGLSGR
PWYKHLIYAPSLHNDYGAQVYPGVDDAIQKAKKTNTSESWQSVQHEIYRVSRVINQAALV
LSGDLT
Download sequence
Identical sequences C5XK00
jgi|Sorbi1|5053688|Sb03g034260 XP_002456339.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]