SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5053691|Sb03g034310 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5053691|Sb03g034310
Domain Number 1 Region: 481-801
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.92e-100
Family Motor proteins 0.00000352
Further Details:      
 
Domain Number 2 Region: 14-114
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000000223
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5053691|Sb03g034310
Domain Number - Region: 270-442
Classification Level Classification E-value
Superfamily Tropomyosin 0.0464
Family Tropomyosin 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5053691|Sb03g034310
Sequence length 921
Sequence
MGNVDGEHEFHAANRRAEVIDWLGGLLPEFDLPLDSSDEELREYLIDGTALCYIAEKLMP
GIQEEMWGGNASDQRSNVKKFLYFVAEMGLPGFSVKDLEEGSVSSVVECLLALKDNVTTG
LGQNITNNAAKTPLRRKLELEESDGPIISVMTPGKRSGEERWKGHWDPKSQQRSILHSGQ
KVHDAFQLKRGSYTDLPPAKVSEMMHPRSLDNAPTQSLLRVVNGILDESIERKRGEIPHR
VVYLLRNVVQEIEHRIAIQADHIRNQNSIIKTREDKYRSKIKALETLVNGTNEENEMTVN
RLELVEVEKSKLDEKRKLGEQDMVRLMQEKENAENTIASLQQEIQILSRMHEQYRERKET
EARQMEEHMAMRLKDAEFLLMQSKKKVEEIESASQLKSQLWSRKANILQSFMDNQKLSIK
DIRISSQSIKQEMFTLQMKWRDEISNIGHDLNGLVDAADNYHKVLAENQKLFNEVQELKG
NIRVYCRVRPFLPGQDGKTTVIDYIGENGEILITNPFKQGKDVCRMFKFNKVFNTHVSQA
EVFSDIQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPGTSKDDWGVNYRALNDLFDISL
SRRNAFSLHPVKSTLDVLELMQIGQTNRAVGSTALNERSSRSHSILTVHVRGVDLKNGST
TRGCLHLIDLAGSERVERSEAIGDRLKEAQYINKSLSALGDVIFALAQKNAHVPYRNSKL
TQVLQSSLGGQAKTLMFVQINPDTESYLETISTLKFAERVSGVELGAARSNKEGKDIKEL
LEQVSYLKDTISRKDMEIDQLLKDKVKSPSSLTYRNDSNQQIRRQSGAGGSCEAECEDNI
SDDGCSVAGTECSVGGASEATPERMQKAPSRIARLFLTKNGQPANPKPKPRESALKPPGR
TTSTGSQATGGASSVKPPKRR
Download sequence
Identical sequences 4558.Sb03g034310.1 jgi|Sorbi1|5053691|Sb03g034310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]