SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5053782|Sb03g035770 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5053782|Sb03g035770
Domain Number 1 Region: 174-219,248-452,589-726
Classification Level Classification E-value
Superfamily Subtilisin-like 2.75e-71
Family Subtilases 0.0046
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5053782|Sb03g035770
Domain Number - Region: 454-524
Classification Level Classification E-value
Superfamily PA domain 0.0392
Family PA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5053782|Sb03g035770
Sequence length 868
Sequence
MGVARREEHRAAAAAFLYAVTVLGVLAGGAGVRAFEDGTAVYIVTMKQSPVFHRRLTLEK
FGSSRVATAVGRGRGGGGGGGGGAAGGAGDTPTTSVLTKPRQGSPKPMNYGSYIVHLQNA
LLKRTLRGEHYIKLYSYRYLINGFAAVITPLQADKLSRRKEVANVMLDYSVRTATTHTPE
FLGLPQGAWVQEGGPQFAGQGVVVGLIDTGIDPTHPSFADDLSTDSYPVPAHYSGICEVT
NDFPSGSCNRKLVGARHFAASAITRGVFNASQDLASPSDSDGHGTHTASIAAGNHGIPVV
VAGHQFGNASGMAPRAHIAVYKALYKSFGGFAADVVAAIDQAAEDNVDIISLSITPNRRP
PGLATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSMSSYSPWIFTVGASAHDRVYSNY
VVLGNNLTIQGVGLAPGTDGDCMYTLVAAPHALKNNTVSPTEMSLGECQDSSRLDADLIR
GKILVCSYSIRFVLGLSSVKQALDTANNVSAAGVIFYLDPFVLGFQLNPTPMHMPGLIIP
SSDDSKVFLTYYNDSLVRDETSGQVVSFGGVAKILGGLNPNYGNSAPKVMFYSARGPDPE
DNSLSNADILKPNLVAPGSSIWGAWSSLGLDSAEFAGESFAMLSGTSMAAPHVAGLAALI
KQKFPSFSPAAIASALSTTTTLSDRQGKPIMAQRTYSNPDSTQSPATAFDMGNGFVNATA
ALDPGLVFDCSYDDFFSFLCGINGSSPVVTNYTGNSCVASTMTGADLNLPSITIAVLNQT
RAITRTVTNVAAADESYTVSYSAPYGTAVSVVPTQFLIPSGQKQLVTFVVNATMNSSSAS
FGNVGFYGDKGHRAIIPFSVISKVVYSP
Download sequence
Identical sequences C5XKZ2
4558.Sb03g035770.1 XP_002456409.1.57931 jgi|Sorbi1|5053782|Sb03g035770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]