SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5053823|Sb03g036630 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5053823|Sb03g036630
Domain Number 1 Region: 534-823
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-80
Family Protein kinases, catalytic subunit 0.0000777
Further Details:      
 
Domain Number 2 Region: 76-188
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.62e-26
Family alpha-D-mannose-specific plant lectins 0.0075
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5053823|Sb03g036630
Domain Number - Region: 349-413
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00549
Family Anti-platelet protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5053823|Sb03g036630
Sequence length 869
Sequence
MTARTLSLLLLLAAAASSFTPSTSTDTIYRNTSLTGNQTLVSAGGIYELGFFSPAGANGR
TYLGIWYASIPGATTVVWVANRRDPVTNSPAALQLSAGGRLVILDGNNDTVWSSPAPTVG
NVTARAAAQLLDTGNFVLSGDGSGSGPSVAWQSFDYPTDTLLPGMKLGVDTRASITRNIT
AWRSASDPSPGDVTFKLVIGGLPQFFLLRGSTRVYTSGPWNGDILTGVPYLKAQAFTFEV
VYSADETYYSYFIREPSLLSRLVVDGAATQLKRFSLNNGAWNSFWYYPTDQCDYYAKCGP
FGYCDTDRSPPCSCLPGFVPRSPDQWNQKEWSGGCVRSTNLTCDGGGGDGFWVVNRMKLP
QATDATVYAGMTLDQCRQACLGNCSCGAYAAANNSGGIGVGCVIWTVDLLDMRQYPIVVQ
DVYIRLAQSDIDALKAAAADNHQRSHKSKLIIIVVATISGVLFLLAAAGCCCLWMKNKVS
KKGEGEDMASSMPPSTAEFALPYRIRSQPSLSPVRDHKQLLDVSDETRYSGNDVDLPLFE
LEVILAATDNFADHKRIGAGGFGPVYMGVLEDGQQIAVKRLSQGSTQGVREFMNEVKLIA
KLQHRNLVRLFGCCIENDERMLVYEYMHNQSLDTFIFDEAKRRLLRWQKRFEIIQGIARG
LQYLHEDSRFRIIHRDLKASNVLLDRNMVPKISDFGIARMFGGDQTSAYTRKVVGTYGYM
APEYAMDGQISIKSDVFSFGVLVLEIIAGRRNRGSYEPDLDVNLLGYAWMLWREGRSMEL
LLDEALGGSFHHSRVLRCIQVALLCVEAQPRNRPLMSSVVTMLASDNAVLPEPNEPGVNP
GMSTSSDTESSRTRSATANYVTVTRLEAR
Download sequence
Identical sequences 4558.Sb03g036630.1 jgi|Sorbi1|5053823|Sb03g036630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]