SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5053824|Sb03g036640 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5053824|Sb03g036640
Domain Number 1 Region: 478-734
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-71
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 75-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.14e-24
Family alpha-D-mannose-specific plant lectins 0.0054
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5053824|Sb03g036640
Domain Number - Region: 353-417
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000247
Family Pan module (APPLE domain) 0.08
Further Details:      
 
Domain Number - Region: 290-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5053824|Sb03g036640
Sequence length 778
Sequence
MRACALHLVLLATAAAFFPLSTSTDTLGPSESITTGNNQTLVSAGGVFQLGFFSPDGGAR
TYLGIWYYNITLHTVVWVANRQSPVRSTPAVLRLSVDGRLVILDGQNGTVWSSAAPTVNV
TAGGTLRLLDSGNFILSADGSGSDSDQSVAWQSFDYPTDTLLPGMKLGVDVKAGITRNIT
AWRGASDPAPGDVTFKLVTGGLPQFFLLRGDTRLYTSGPWNGEILTGVPYLKSNDFTFKV
VYVPGDETYYSYSIGGDALLSRLVVDEAAGQVQRFVLLNGGWSNFWYYPNDPCDSYAKCG
PFGYCDNTGQSQACVCLPGFQPRSPQQWNLRDGKAGCVRTTSLSCGGANASSDGFWVVKR
MKLPEATNATVYPGMTLDQCRQACLGNCSCRAYAAANVSGGVSRGCVIWAVDLLDMRLFP
TDVEDVYIRLAQSEIDALNAAGRGGNVNARRIPRRRAAETTCSRSGQGNSKRWTRTGKGK
LEDGQEVAVKRLSRRSMQGAVEFKNEVKLIAKLQHRNLVRLLGCCVDEEERMLLYEYMHN
QSLDTFIFDEGKRSLLRWQKRFDIILGIARGLQYLHEDSRFRIIHRDLKASNVLLDRNMV
PKISDFGIARMFGGDQTTAYTLKVIGTYGYMSPEYAMDGVFSMKSDIYSFGVLVLEIITG
KRNRGFYEEDLDLNLLRYAWMMWKEGRSVELVDKVMDGSGVNYSEVLRCIQVALLCVEVQ
PRNRPLMSSVVMMLASENATVPEPNEPGVNIGKNTSEDTDSSHGLTANSVTITAIDAR
Download sequence
Identical sequences jgi|Sorbi1|5053824|Sb03g036640 4558.Sb03g036640.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]