SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5053825|Sb03g036650 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5053825|Sb03g036650
Domain Number 1 Region: 512-798
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-80
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 69-157,189-219
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.63e-23
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5053825|Sb03g036650
Sequence length 846
Sequence
MASPLLCVLLYLLRHLAACHAATARDTITPGTPLAANETLVSGGEGNFALGFFTPPGANS
TYLGVWYNKVSLRTVVWVANREAPIAGAVGDNPGATLSVSAGGTLAIAAGNKTVVWSVQP
ASKLATPTAQILDNGNLVLADGVGGAVAWEGFDYPTDTMLPEMKVGIDYVKKKNRTLTSW
KSASDPSPGPVAMVMDTNGDPQVFIWNGGEKVWRSGPWDGVQFTGVPDTATYSGFTFSFI
NSAQEVTYSFQVHNASIISHLGVVSTGNYGLLQRSTWVEAAKAWNLYWYAPKDQCDAVSP
CGPNGVCDTNNMPVCSCLHGFTPKTPAAWALRDGRDGCVRSTPLDCRNGTDGFITVRHAK
VPDTERSAVDWSLTLEQCRQACLRNCSCTAYASANVSVGAGGGRGNGAGSGCVMWTTGLT
DLRVYPDFGQDLFVRLAAADLDVLEAKSREARIKIGVGVGVSVLALLLAVAGLLIWSRRR
KLTRTAGSSKWSGASRSTGRRYEGSSHDDDLELPIFDLGTIAAATDGFSINNKLGEGGFG
PVYKGKLEDGMEIAVKTLSKTSAQGLDEFKNEVLLIAKLQHRNLVRLLGCSISGQERMLV
YEYMANKSLDYFLFEKDNVVLDWQVRYRIIEGITRGLLYLHQDSRYRIIHRDLKAANVLL
DTEMTPKISDFGMARIFGNEETEINTRKVVGTYGYMSPEYAMDGIFSVKSDVFSYGVLLL
EIVSGRRNRGVYSCSNNQSLLGHAWSLWNEEKSIELADERMNGSFNSDEVQKCIRVGLLC
VQENPDDRPLMSQVLLMLASPDATSLPTPKQPGFAARRVLMETDTSSTKPDCSIFDSATI
TMLEGR
Download sequence
Identical sequences C5XLS4
4558.Sb03g036650.1 XP_002458611.1.57931 jgi|Sorbi1|5053825|Sb03g036650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]