SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5053838|Sb03g036840 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5053838|Sb03g036840
Domain Number 1 Region: 125-218
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.4e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5053838|Sb03g036840
Sequence length 220
Sequence
MASATGGSSSEMAVDHPTGPGAVEKPQFDALMPSEMSGGRPQFRKVTVPQHRFAPLKRCW
MEIYTPVYEHMKIDIRMNLKARRVELKTRQDTPDVSNLQKCADFVHAFMLGFDIADAVAL
LRLDDLYVDSFEIKDVKTLRGEHLSRAIGRLSGKGGKTKYAIENSTRTRIVIADTKIHIL
GSFVNIKVARDSLCSLILGSPAGKVYSKLRAVSARLAERY
Download sequence
Identical sequences C5XMC6
XP_002458621.1.57931 jgi|Sorbi1|5053838|Sb03g036840 4558.Sb03g036840.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]