SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5054108|Sb03g041380 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5054108|Sb03g041380
Domain Number 1 Region: 27-339
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.01e-42
Family SGL-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5054108|Sb03g041380
Sequence length 347
Sequence
MGGQRLNLTTSSLLAVVVLALLAAPSAAAAQVKTTDTRWSFRLPLPSGVSGAESLAFDGK
GEGPYAGVSDGRVLKWGGSSVGWTTYAHSANYRKIPLCTAGVLPSTETESLCGRPLGLQF
HAKTGDLYIADAYLGLMRVGPGGGEAEVLATGSDDGVPFNFVNGLDVDQATGDVYFTDSS
ATYPRRFNTEIMMNADATGRLLRYDARTGGVTVLRSGLPYPNGVAVSRDGAQVVVAHTVP
CQAFRYFLRGARAGQYELLADLPGYPDNVRRDGKGGYWVALNQEKQRLDATSETAPVKHL
VGVRLDAQGVEVEELTAAKGVTLSDVAERRGKLWLGSVELEYVGLVA
Download sequence
Identical sequences C5XRB6
jgi|Sorbi1|5054108|Sb03g041380 4558.Sb03g041380.1 XP_002456721.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]