SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5054151|Sb03g042090 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5054151|Sb03g042090
Domain Number 1 Region: 147-266
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.91e-30
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5054151|Sb03g042090
Sequence length 293
Sequence
MDERIPPPSLLQYSQSPVHSSPHPLNSMRYSSSERERYLAELLAERQKLAPFVQVLPFCT
RLLNQEILRASSMAPNHNFVDPERIEHGSPLRLPGHPVNGQPMDLEGWTGIQTEASQHMG
VLQASSMGWNGAPVLAATPVVKKVMRLDVPVDKYPNYNFVGRLLGPRGNSLKRVEASTQC
RVYIRGRGSVKDSVKEDKLRDKPGYEHLNEQLHVLVEAEFPVDMVDARLNQAVSILEDLL
KPIDESMDFYKKQQLRELAILNGTLREESPSPHLSPSVSPFNSTGMKRAKTGR
Download sequence
Identical sequences C5XEN5
jgi|Sorbi1|5054151|Sb03g042090 XP_002456759.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]