SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5054855|Sb04g006740 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5054855|Sb04g006740
Domain Number 1 Region: 14-206,320-447
Classification Level Classification E-value
Superfamily Subtilisin-like 7.86e-61
Family Subtilases 0.01
Further Details:      
 
Domain Number 2 Region: 225-298
Classification Level Classification E-value
Superfamily PA domain 0.00000484
Family PA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5054855|Sb04g006740
Sequence length 590
Sequence
MGLDFILSLFFAFFLNGYAAASGVLNASTNTPRDPGGHGTHTLSTAGGSPVPGASVFGFG
NDTASGGSPRARVAAYRVCYPPVNGSECFDADILAAFDAAIHDGVHVLSLSLGGDPSDYF
DDGIAIGAFHAVRRGISVVCSAGNSGPALGTASNLAPWLFTSGASTMDREFPSYIVYDRT
KKAKGQSLSITTLPEKTSYPLIDSVKAAAANASTKDAQLCMIGALDPAKVKGKIVVCLRG
INPRVAKGEAVKQAGGVGMVLANDVTTGNEIIADAHVLPATQIKYSDGLHLYSYLNSTKN
PAGFITKPATVLGTKPAPFMAAFSSQGPNTITPEILKPDITAPGVSVIAAWTRANSPTDL
AFDPRRVAFNSQSGTSMSCPHVSGVVGLLRTVHPQWSPAAIKSAIMTTAIEMDNKGELIL
NSSSRSSSPFGYGAGHIYPTRALNPGLVYDLGDKDYLDFLCALKYNATVMAMFNGAPYTC
PTGEAPHRISDLNYPSITVVNVTSAGATARRRVKNVAKPSTYRAFVVEPAGVSVVVNPSV
LKFSAKGEEKGFEVQFKVKDAALAKGYSFGALAWTNGVHFVRSPLVVKAA
Download sequence
Identical sequences 4558.Sb04g006740.1 jgi|Sorbi1|5054855|Sb04g006740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]