SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5055427|Sb04g025640 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5055427|Sb04g025640
Domain Number 1 Region: 609-910
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-72
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 497-541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000011
Family EGF-type module 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5055427|Sb04g025640
Sequence length 963
Sequence
MAILIGTHLLLRLTCLLGSSVPRVSGRDSGFAGAGAGGAPGGGGILSVPSADSLAHCPTR
CGDAEFLYPFGTEPGCFRQGFELTCDNTTQPPKLFWANSSSTQMLGTDRTDHYFAYASIG
FSIAVTPGTTSTYTRSWESPAKGFAIDSDTRMYLVGCDVEVVLFDAGTNLTIGSCSSSCP
ADRATMAMGMAPMEPENNCNGFGCCSIALPEYLQGFRFTLSSRDAAGSSSSSSTAKVFLT
EDYGFNTSDLYSSWIDQSSSVQTSLEIFATDQPSCEIASANKETFACSAGSLCQTGEWGG
YFCYCNPRVSGNPYILDGCIEGYDPIPKENCKRSCGNMSIPFPFGLEERCTAQQKFRLSC
VSNKFVVLDRGDGTNYMVTKLSVNDGYLSVTSMLNDSSSNNDQVVVVHTSDGDFDYRLPN
EAMRGFIEFSQEFDIRMSWAVSNLTCATASQRNNTYACVSAHSECVNVTHGTLYLGYRCK
CSRGFDGNPYVKGLDGCTDIDECLEPNDCNGVCHNTLGGYYCTSCPHGKVFEPTKRNCVT
TAKQHSLLLGVTIGIGSGLGSIIFVLCAIVIARKWKQGLQKRIRRAYFKKNQGLLLEQLV
SDKSTTNKTKIFSLEELEKATNNFDATRVLGRGGHGTVYKGILSDQNVVAIKRSKIMEQT
EIDQFINEVAILSQIIHRNVVKLFGCCLETEVPLLVYEFISNGTLYSLLHTNVGDKCLLS
WDDRTRIAVESSGALAYLHSAATIPIFHRDVKSSNILLDAALTTKVSDFGASRSISLDET
HVVTIVQGTFGYLDPEYYNTGRLTEKSDVYSFGVIIVELLTRKKPVFIDDAGMKQSLAHY
FIEGLQEGALMEIIDQQILEEADQGEIDDIALLAQACLRTKGVERPTMKEVEMKLQLLRT
GRLKKRYHSLVNNGEPEHLLCPSHARNSHARLDLANATRLPYEETSRGYSLEKEFASSIS
LPR
Download sequence
Identical sequences jgi|Sorbi1|5055427|Sb04g025640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]