SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5055667|Sb04g029730 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5055667|Sb04g029730
Domain Number 1 Region: 125-626
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-166
Family Calponin-homology domain, CH-domain 0.000000000000814
Further Details:      
 
Domain Number 2 Region: 14-93
Classification Level Classification E-value
Superfamily EF-hand 0.0000215
Family Calmodulin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5055667|Sb04g029730
Sequence length 704
Sequence
MSGFVGVVVSDPSLQGQFTQVELRSLKAKFVSLKRDSGHVTTKNLPGLMKKLRGLNEVVS
EEEIAAFLSESYPDSDQEIEFESFLRAYLNLQARVSAKQGGAGGGGGGKSSFLKSTITTL
LHNLNQAEKSSYVAHINTYLREDPFLKKYLPIDPSGNQLFDLIRDGVLLCKLINVAVPGT
IDERAINKKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLILGLISQIIK
IQLLADLNLKKTPQLVELFDDSKDIDEVLSLSPEKMLLRWMNHHLKKAGYKKTVNNFSSD
VKDGEAYAYLLKALAPEHSPETTLDIKDPNERAKLVLEQAEKLDCKRYLTPKDITEGSAN
LNLAFVAQIFQHRNGLTSDTKQVTLSQTATRDDVLLSREERAFRMWINSLGVESYVNNVF
EDVRNGWVLLEVLDKVSPGSVNWKLATKPPIKLPFRKLENCNQVVKIGKQLKFSLVNLAG
NDIVQGNKKLIVALLWQLMRFNILQLLNKLRFHSQGAQGKEISDADILDWANSKVKASGR
TSRMESFKDKSLSNGLFFLELLSTVQPRVVNWKVVTKGEADEDKKLNATYIISIARKIGC
SVFLLPEDIVEVNQKMILTLTASIMYWSLQRQPQSQSEMPEQSEPSSMTSDAASDIASED
GASTTAPSESEEVNSLSDSISNLTMDDATSNAPPAENGNGVEGS
Download sequence
Identical sequences C5XZU7
jgi|Sorbi1|5055667|Sb04g029730 XP_002454381.1.57931 4558.Sb04g029730.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]