SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5055948|Sb04g034250 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5055948|Sb04g034250
Domain Number 1 Region: 504-815
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-72
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 83-206
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.62e-18
Family alpha-D-mannose-specific plant lectins 0.007
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5055948|Sb04g034250
Domain Number - Region: 363-401
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00589
Family Pan module (APPLE domain) 0.052
Further Details:      
 
Domain Number - Region: 130-271
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0243
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5055948|Sb04g034250
Sequence length 884
Sequence
MPPTRLHLAVLLLLGVASDRARGGRVATELVTPDFTASYLLFQDSYGAFLASPSGAFHAA
VYNPRDQLERFYLAVLHAPSKTCVWVANRAAPITDRAAPLQLTAKGISAEDPNGTTIWST
PPFGEPVAALRLDDHGNLALLDARNATLWQSFDRPTDSIVSSQRLPAGAFLASAASDSDF
SEGDYQLNVTAADVLLTWMGSMYWRLSNDASSTVDRGGTVAYMAVNGTGLYLLAADGGVL
VQVSFPAAELRIVRLGYDGKLQIVSFASANSSKSPMDGGFVAPRDACALPLFCGALGLCT
PKGCTCPPLFAATHDGGCAPSDGSTPLSVSSCGGAGGGGNNSLPVSYLSLGNGVGYFANK
LAPPTVSGKNVSSCQALCTSNCSCLGYFYDDSALSCYLVQHQLGSFMNADSTQGSDKLGY
IKVQSSKPSRTSSSSSSNSTLMAILLPTIIAFVLIVVVSAAVIRAWRKEAGRSSRSRDQQ
VRRQRSPSDSAHLVRDIDDDDDDIVIPGLPTRFTHHEIEDMTNSFRIKIGAGGFGAVYKG
ELPDGSEVAVKKIEGVGMQGKREFCTEIAVIGNIHHINLVRLRGFCTEGQRRLLVYEYMN
RGSLDRSLFRPTGPLLEWKERMDVAVGAARGLAYLHFGCDQKIIHCDVKPENILLADGGQ
VKIADFGLAKLLTPEQSGLFTTMRGTRGYLAPEWLSNTAITDRTDVYSFGMVLMELVRGR
KNRSEHVSDGGGEASNSSNGTTGSSSRGAKSDYFPLAALERHEAGQQYAELADPRLQGRV
VAEEVERVVKVALCCLHEDPHLRPSMAVVVGMLEGAMPLWEPRVESLEFLRLYGRGFPGP
ADGGGSDMNLKHMASPMDRSGRTTSTTMSGWPSYLSSSQLSGPR
Download sequence
Identical sequences C5XSW0
jgi|Sorbi1|5055948|Sb04g034250 XP_002454609.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]