SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5055992|Sb04g034980 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5055992|Sb04g034980
Domain Number 1 Region: 119-165,193-396,503-631
Classification Level Classification E-value
Superfamily Subtilisin-like 2.75e-78
Family Subtilases 0.0055
Further Details:      
 
Domain Number 2 Region: 378-476
Classification Level Classification E-value
Superfamily PA domain 0.000000484
Family PA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5055992|Sb04g034980
Sequence length 787
Sequence
MARIRGPRLAVLLALAVLAAVAVAAVAAAAAAEERAQSTYIIHLSPGHPALSAARANGGG
EAVLRRLLPRRLRAPRPRVLYSYQHAATGIAARLTPEQAAHAAAGEGVLAVYPDKVRQLH
TTHTPSFLGLTETAGLLPAAAGGASSAVVGVLDTGLYPIGRGSFAATAGLGPPPASFSGG
CVSAASFNASAYCNSKLIGAKFFYQGYEAGLGHPIDETKESKSPLDTEGHGTHTASTAAG
SPVPGAGFFDYAKGQAVGMDPGARIAVYKICWASGCYDSDILAAMDEAVADGVDVISLSV
GANGYAPRFYTDSIAIGAFHAVRKGIVVSCSAGNSGPGEYTAVNIAPWILTVGASTIDRE
FPADVVLGDGRVFGGVSLYAGDPLDSTQLPLVFAGDCGSRLCLIGELDPKKVAGKIVLCL
RGNNARVEKGAAVKLAGGVGMILANTEESGEELIADSHLVPATMVGQKFGDKIRYYVQTD
PSPTATIMFRGTVIGKSPSAPQVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGAASP
TDLDIDTRRVEFNIISGTSMSCPHVSGLAALLRQAHPEWSPAAIKSALMTTAYNLDNSGE
TIKDLATGVESTPFVRGAGHVDPNAALDPGLVYDAGIDDYVAFLCTLGYSPSLISIFTQD
GSVANCSRKFARSGDLNYPAFAAVFSSYQDSVTYHRVVRNVGSNSSAVYEPKIVSPSGVD
VTVSPSKLVFDGKQQSLGYEITIAVSGNPVIVDVSYSFGSITWSDGAHDVTSPIAVTWPS
NGGAAAM
Download sequence
Identical sequences C5XTM6
jgi|Sorbi1|5055992|Sb04g034980 XP_002454656.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]