SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5056131|Sb04g037220 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5056131|Sb04g037220
Domain Number 1 Region: 400-697
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-76
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 295-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000027
Family EGF-type module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5056131|Sb04g037220
Sequence length 703
Sequence
MRQPAMPWRSPLWLLLLATMLSTTRLLALAGGMARPGCQERCGNLSIPYPFGIGPGCFRS
GFEVRCDNDAGEAYLGGKGSNLWAFDIFLLQGEARVHKHLTWDCYNDTGITDFARSPMDL
ASYYQISHTKNKFTAIGCDTIAFIQGENANSYTSGCMSFCSSNASVDTSGQCTGMGCCQT
SIPANLTYFNTTFSTRRSTSVLEFNPCSYAFVIETQQFRFDVSDLADHHFADKYSDGVPL
VLNWVVGEESCDEAKKNMSSYACLSKNMAMGGIHIWKKAAKVDLMSILVSLVTLTDIDEC
AFPEQYLCFGQCTNTIGSYSCTCPKGTRSTDASMINCVPYQDPTQTVKMVLGISISTVFL
LLCIFTVVIQYQKRKLIKEKDGFFKQNGGFILLEKMRSRRVDTVRVFSKEELENATNNFD
KRRELGRGGHGTVYKGIMKDNRVVAIKRSKVCNTNQKDEFVQEIIILSQINHRNVVRLLG
CCLEVEVPMLVYEFIPNSTLFQLVHSEGSFISLDDRLRIALESAEALAYLHSSAFPPIIH
GDVKSSNILLDDNYTAKVTDFGGSHMLAKNETQFMTMVQGTLGYLDPEYLQERQLTEKSD
VYSFGVVILELITRKTAIYSEDSSERKGLASSFMMAMKENKLQDMLDKSIIGVGMEPLRV
ISELAKKCLSMKGDERPQMTEVVEQLKVIRRTWQENLTKHHAV
Download sequence
Identical sequences 4558.Sb04g037220.1 jgi|Sorbi1|5056131|Sb04g037220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]