SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5056160|Sb04g037690 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5056160|Sb04g037690
Domain Number 1 Region: 39-111
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 126-198
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.21e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 3 Region: 257-337
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.65e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5056160|Sb04g037690
Sequence length 343
Sequence
MEAPGSPYASSPESAPKRAPRSPPQQQPPSEEGDDKEKPTHLRFLVSNTAAGCIIGKGGS
TINDFQSQSGARIQLSRSHEFFPGTNDRIIMVSGLFDEVMKAMELILEKLLAEGEEFNEA
EARPKVRLVVPNSSCGGIIGKGGATIKSFIEESHAGIKISPQDNNYVGLHDRLVTVTGTF
DNQMNAIDLILKKLSEDVHYPPNLSSPFPYAGLTFPNYPGVPVGYMIPQVPYNNAVNYGP
NNGYGGRYQNNKPSTPMRSPASNEAQESLTIGIADEHIGAVVGRAGRNITEIIQASGARI
KISDRGDFISGTSDRKVTITGTSEAIRTAESMIMQRVSASSER
Download sequence
Identical sequences C5XW10
XP_002453064.1.57931 4558.Sb04g037690.1 jgi|Sorbi1|5056160|Sb04g037690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]