SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5056163|Sb04g037790 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5056163|Sb04g037790
Domain Number 1 Region: 99-144
Classification Level Classification E-value
Superfamily PA domain 0.00000000103
Family PA domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5056163|Sb04g037790
Sequence length 547
Sequence
MARRALEPAAVLLVLAALAAVAAGGDIRHQDDDAPKIPGCSNDFVLVKVRTWINQKDKIE
FVGVGARFGPKIESKEKQSNWTNLLLPDTSDCCTPPKEKVAGDILLVERGNCTFTTKARV
AESAGASAIIIINDKQELYKMVCETNETNLDIGIPAVLLPKDAGSSLERSLSSGEVLVEL
YSPDRPLVDTAEVFLWLMAVGTILCASYWSAWSAREADIEQEKLLKDGHEVPPNFEAGGS
SGMVEINMVSAILFVVIASCFLITLYKKMSHWFVELLVVIFCIGGVEGLQTCLVGLLSMS
RWFKPAAGSFVKVPFFGAVSYLTLAVCPFCIVFAVLWGVYRRLSFAWIGQDILGITLIVT
VIQIVRIPNLKVGSALLSCAFLYDIFWVFISKMIFHESVMIVVARGDKTDEDGVPMLLKI
PRMFDPWGGYSIIGFGDILLPGLLVAFALRYDWAAKKTLQSGYFLWSMVAYGSGLLITYV
ALNLMDGHGQPALLYIVPFTIGTFLALGMKRGELRNLWTKGQPERVCTHMHTHPSPKDSP
VAVSSTS
Download sequence
Identical sequences C5XW22
XP_002453071.1.57931 jgi|Sorbi1|5056163|Sb04g037790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]