SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5056353|Sb05g003000 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5056353|Sb05g003000
Domain Number 1 Region: 93-170,275-302
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000394
Family alpha-D-mannose-specific plant lectins 0.0093
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5056353|Sb05g003000
Domain Number - Region: 378-420
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00471
Family Pan module (APPLE domain) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5056353|Sb05g003000
Sequence length 511
Sequence
MRRGKGDDPAIAAAAAIAVLCVTSAVLLVNGATEGEELTTQLSNGFTAAHAAGAPVPFEP
VLYAASGAFAFGFLRVGAASLDLAVVHLPSSFPVWRATPARLGNWSRPATLTFDDGSLVL
LTDHDDNDDVLWRTVDAVGDVVVLLESSNLVVRRYERTVPEWESFDHPSDTLVLGQNFTG
SSPPLVSANRRFALRLGKTYMALHMEFYGGGRTKMTPTYWRHTALMANPENATEPPVYGR
LDARGFFGLYLDGGRGDERVDVLSFDTFVQNLTGVFRRMTLDDDGNLRAYYWASGSKAWT
SDYRAISERCELPTPCGAYGLCVPGKAECQCLLDNSTRAAAPSCHAEETADLCAGSGQQL
GFEVVRRKRVSVAYKEELPFETNRTAAECEAACAANCSCWAALHSGASGYCYLIDFPVET
LVYEADDRKVGYFKVRKSPPASTTTGMSPDVAAVTAALSLVLVGLAMAGVCIGYQIRERR
ERRRAGMEHELVPVTYKDLRSMDSSNNSFRA
Download sequence
Identical sequences C5Y4M3
XP_002448995.1.57931 4558.Sb05g003000.1 jgi|Sorbi1|5056353|Sb05g003000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]