SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5056605|Sb05g018940 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5056605|Sb05g018940
Domain Number 1 Region: 110-202
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000336
Family alpha-D-mannose-specific plant lectins 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5056605|Sb05g018940
Sequence length 316
Sequence
MELLPCIATLLILLSCSLAAATSPLGTIERVTKQQILASIPPVGGAPVLFLTSPSGKYAA
YFVRTHTVPGAGGLGADFCYVEIIDTTTTAASGAHGGTVEGEEEGAAGTSVWESECHPIS
TVNTCALLFSWHGLEVFDGAEEVWHGETNTDGTNFLETLELVDDGDMRIRDKDGELAWRA
SDEPRHAQHCGAPGSPGLAAALPPFAEPLGAHSSNLPFGQEPDGNGHSAELPQAADVGSG
AAAFGGAAGVTGPELGQGEHDPAGVGGAAAGFGTQPLVDNSPYDSGAWKEGRGAHITAIG
VALCVCAVLGAMGTGL
Download sequence
Identical sequences C5Y2T8
XP_002449548.1.57931 jgi|Sorbi1|5056605|Sb05g018940 4558.Sb05g018940.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]