SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5056872|Sb05g027440 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5056872|Sb05g027440
Domain Number 1 Region: 368-684
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-74
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 1-58
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000824
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5056872|Sb05g027440
Domain Number - Region: 225-286
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00471
Family Anti-platelet protein 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5056872|Sb05g027440
Sequence length 707
Sequence
MRDNGNLVLLDGGDSNSTVLWQSFDHPTDTLVPEAWLGEDKVTGEYQTLTSWRNAEDPSP
GMFTNTVDPYNGSSSEFFYLWNGSHAYWRSGVWTGRVFANVPEAVNNVLFNETYADTPAY
RRVTSVLYDNATVTRLVMDLTGQTKQFIWVPATQSWQFFWAAPTVQCDVYALCGDFGVCN
QRTQPPCQCPPGFAPAADRDWGLSDWTAGCRRTLPLQCGGNGSTDGFLELPDMKLPDDDD
TALSMAAAQSKTDCELACLNNCSCQAYTFSAGGGGGCAVWHHGFRNLQQLFPGDAGGGGS
SSSASSSLYLRLSESELRHLRGAKGRSKNRRWLAIGIVLACVAALGVSAVAAWILVSRRR
RRAEMAKQQKGSSSLVVYSYGDLRSATSNFSERLGGGSFGSVYRGVLNGDGHTQVEVAVK
KMEGLRQGDKQFRAEVNTLGLIQHVNLVRLLGFCCSGDDDDDGDKLLVYEYMPNGSLESY
LAGSSCPSWRHRYGVMVGTARGLAYLHDGCRERIIHCDIKPENILLDGDFTPKIADFGMA
KLVGRDFSRALTTMRGTVGYLAPEWISGMPISAKADVYSFGMVLFELISGRRNTATGEGR
RRRRHGASSDADDDDEDREATTTFFPVWAAVRVAEGDTAAVADARLRGDVSEDELERACR
VACWCIQDEEAHRPTMAQVVQALEGVVDVDMPPVPRALQHLATTTLT
Download sequence
Identical sequences jgi|Sorbi1|5056872|Sb05g027440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]