SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5056991|Sb06g002210 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5056991|Sb06g002210
Domain Number 1 Region: 480-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-77
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 60-209
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.66e-19
Family alpha-D-mannose-specific plant lectins 0.006
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5056991|Sb06g002210
Domain Number - Region: 363-399
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0216
Family Anti-platelet protein 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5056991|Sb06g002210
Sequence length 795
Sequence
MAALLLLSLLLLLSSTPLQAQQNITLNSSLTPQGPSTSWLSPSGDFAFGFRPIEGNTSFY
LLAVWFNKIGDQTVAWYAKTTDSDPAPVQVSSGSRLLLNSNGALSLQDSTGTEVWNPQIV
GASYAAMLDSGNFVLVASDGSTKWGSFKNPTDTILPTQVLTTGMSLRSRIIPTDYSNGRF
LLDLQSTGVSLYTVAVPSGHQYDPYWSMDVNTTNLVFNATGVIYIGNQSEITSWVISSIA
NYYLRATLDPDGVFRQYMYPKKASNQSNQEWSVVDFKPPNICDAQLTNVGSGICGFNSYC
IWSGTNNLSTCMCPEQYSFIDDKRKYIGCKPDFEPQSCDLDEAAVMMQFKLIPVSHVDWP
LSDYEQYSPITADQCQKLCMTDCFCALAVFHDEDNTCWKKKMPLSNGHMGDDVQRTVYIK
VRKNNGTQSEIIASNKWKKDKKNWIIGSSLFLGSSVLVNILLISIILFGTYCTITIKEVP
SMQSPNNIGLPLKAFTYTELEKATGGFQKVIGTGASGIVYKGQLQDDLSTHIAVKKIDKL
EHETEKEFTSEVQTIGRTHHKNLVRLLGFCNEGKERLLVYEFMTNGSLNRFLFGDTKLQW
NIRAQLALGVARGLLYLHEECSTQIIHCDIKPQNILLDGDFTAKISDFGLAKLLRTNQTQ
TNTGIRGTRGYVAPEWFKNIGITAKVDVYSFGVILLELVCCRRNVELEAAEEDQKILTDW
ANDCYRCGRIDFLVEGDDEAISDLKNVERFVAVALWCLQEDPTMRPTMRKVTQMLDEAAA
VPSPPDPTSFVSTLA
Download sequence
Identical sequences C5YCQ1
jgi|Sorbi1|5056991|Sb06g002210 4558.Sb06g002210.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]