SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5057003|Sb06g002950 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5057003|Sb06g002950
Domain Number 1 Region: 132-379,481-610
Classification Level Classification E-value
Superfamily Subtilisin-like 1.83e-59
Family Subtilases 0.0044
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5057003|Sb06g002950
Domain Number - Region: 372-465
Classification Level Classification E-value
Superfamily PA domain 0.000628
Family PA domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5057003|Sb06g002950
Sequence length 761
Sequence
MPTILTPSLIFVLAIFLSPPAAAGDIATATTTTTGAAGDAVRTYLVVVCRATGPKENGEK
LREWHASLLASVLNTSTGTVLEEARTPEGGQLVYSYQHVVSGFAARLTVREVDALRKLKW
CVDAIPDVNYRLQTTYTPTLLGLSTPTTGMWAAARNMGEGVIVGVLDNGIDPRHASYGDE
GMPPPPAKWKGRCEFGGAPCNKKLIGGRSLTAWEHGTHTSSTAVGAFVGDVQVLGTNVGT
ASGMAPRAHLAFYEVCFEDTCPSTKQLAAIEQGAFMDNVDVISISASDDTAKPFYQDLTA
VGSFSAVTSGVFVSSSAGNQGPDYGTVTNCAPWVLTVAASTMTRRVVSTVSLGNGMVIQG
EVNQRYTDVKPAPLIYVHGVFENGSLSAVDVRGKVVFCDLSESTTLRGEKVRAAGGVGII
FFNDASGGRVTMFGGNVSIAAARVSQADGEKIMSYINSTANPTAGLHFAGVTLDPSYQPA
VAIYSSRGPCNMSNLGVIKPDITGPGTSIIAAVPDAGGGGNGSAPTPTRTFGLMDGTSMA
APHLSGIAAVLKRARPGWSPSAIKSAMMTTADVTHPDGTPITDEITGKPAGHLLMGSGIV
NPTKALDPGLLYDLSGMDYIPYICGLGYNDTFVNEIIAQPLQNVSCATVSKIEGKDLNYP
SFLVTLTAAAPVVEVRRTVTNVGEAVSAYTAEVVAPPSVAVEVVPPRLEFGSVNQKMDFR
VRFRRVGAAANGTVEGSLRWVSGKYSVRSPIVVLDGTQNLV
Download sequence
Identical sequences C5YD49
4558.Sb06g002950.1 jgi|Sorbi1|5057003|Sb06g002950 XP_002447536.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]