SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5057531|Sb06g022700 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5057531|Sb06g022700
Domain Number 1 Region: 399-683
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-74
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 296-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000774
Family EGF-type module 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5057531|Sb06g022700
Sequence length 745
Sequence
MEVRCLQLGLVCLLLMLASQDAPALAVPNSQCQRQCGGVDIHYPFGIGDNCSLSPGFNVS
CDEVQDGIPKPFIGSVELLNISLIHGTIRVLNPISTSCYNSSSGLMEGNPWLINATDSPY
RFSDVHNKFTVIGCNTLAYISGSDGTGYQSGCVSTCSSLSDLADGSCSGMGCCQTAIPKG
MAYYDVGFDSGFNTSQIWRFSQCSYAVLMEAEAFNFSTSYITTTKFNDTSMGRAPVVSDW
AIRDGTTSCEVAKRNETGTYACLSTNSECVESPNGPGYLCNCSKGYDGNPYLPDGCQDYN
ECKDISSCPSGSICHNTIGGYRCSCRTGRKFSEQNKTCVPDTGLIIGVTVGFLVLVIFSF
FGYMILQKRKLNQVKQEHFRQHGGVLLFERMRSEKGLAFIVFSEAELIQATDNYDKSRII
GKGGHGTVYKGIVKNNMQVAIKRCALIDERQKKEFGQEMLILSQINHKNIVKLVGCCLEV
EVPMLVYEFIPNGTLFELIHGKNQALQISFSTLLRIAHEAAEGLNFLHSYASPPIIHGDV
KSANILLDGNYMAKVSDFGASILAPSDKEQYVTMVQGTCGYLDPEYMQTCQLTEKSDVYS
FGVILLEVLTGQEPLKLDGPETQRSLSSNFLSAMKQNNLDAILPSHMKGQESNELIRGLA
ELAKQCLDMCGSNRPSMKEIADELGRLRKLSLHPWVQINVEMIETQSLLSGTPTASFEIE
ASTTGYPTQEGENLPMNPRSSYYAR
Download sequence
Identical sequences C5YCD2
4558.Sb06g022700.1 jgi|Sorbi1|5057531|Sb06g022700 XP_002448190.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]