SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5057673|Sb06g025100 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5057673|Sb06g025100
Domain Number 1 Region: 137-407,512-638
Classification Level Classification E-value
Superfamily Subtilisin-like 2.49e-75
Family Subtilases 0.0038
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5057673|Sb06g025100
Domain Number - Region: 419-489
Classification Level Classification E-value
Superfamily PA domain 0.00144
Family PA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5057673|Sb06g025100
Sequence length 795
Sequence
MDNPIHSRCTLPCLGLHAAAAVLLLLLLLLSPAAVTPVASHNDHGEHKNYLVIVRSKYEY
DKNVHKNVSSWHASLLSSVCDTAKEALEADPSAMTRLIYSYRSVVNGFAARMTPEELDKM
SKMEWFDRALPEQTFQLLTTHTPEMLGLMGGRRGGGGGLWNTSNMGEGVIIGILDDGIYA
GHPSFDGAGMQPPPPKWKGRCDFNKTVCNNKLIGARSYFESAKWKWKGLRDPVLPINEGQ
HGTHTSSTAAGAFVPNASVFGNGLGTATGMAPRAHIAFYQVCYQDKGCDRDDILAAVDDA
IEDGVDILSLSLGHEDAIDFSDDPVSLGGYTAVLNGVFICAAAGNTGPAPATLVNESPWL
LTVGASTTDRRFLASVKLGDNVELDGESLSDPNTTMDGLLPLVHDMSDGQCLNENVLKAE
NVTGKIILCEAGGDASTAKARMLKSIGVAGMIVVTPEVFGPVVIPRPHAIPTVQVPNEAG
QKIKAYLTKTRGATATFVFKGAALNTPKSPMVAPFSSRGPNRRSRGILKPDLIGPGVNIL
AGVPSIEDVDQLRDAPVPRFDIKSGTSMAAPHLSGIAALIKHAHPTWSPAVIKSALMTTA
EPTDNLRKPILDVDGEPATLLALGAGHVNPKKAMDPGLVYNMTAKGYVPYLCGLNYTDDK
VSTIIYPEPPVSCAKLSKLEQDDLNYPSITAILDQPPFTATANRSVTNVGAASSTYTVEV
NVPESVTVEVNPTKLTFKALEEVLNYSVTIKSANGRALTGPVEGEIKWVSGKYVVRSPIL
VTTGALPSAAATRKP
Download sequence
Identical sequences C5YDM6
XP_002446927.1.57931 jgi|Sorbi1|5057673|Sb06g025100 4558.Sb06g025100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]